SLC39A6 antibody (70R-1720)

Rabbit polyclonal SLC39A6 antibody

Synonyms Polyclonal SLC39A6 antibody, Anti-SLC39A6 antibody, SLCA6 39, SLCA6-39, LIV-1 antibody, SLCA6-39 antibody, SLCA6 39 antibody, SLC39A6, Solute Carrier Family 39 Member 6 antibody
Cross Reactivity Human, Mouse, Rat, Dog
Applications IHC, WB
Immunogen SLC39A6 antibody was raised using a synthetic peptide corresponding to a region with amino acids RSCLIHTSEKKAEIPPKTYSLQIAWVGGFIAISIISFLSLLGVILVPLMN
Assay Information SLC39A6 Blocking Peptide, catalog no. 33R-8173, is also available for use as a blocking control in assays to test for specificity of this SLC39A6 antibody


Immunohistochemical staining using SLC39A6 antibody (70R-1720)

SLC39A6 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 48 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SLC39A6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Zinc is an essential cofactor for hundreds of enzymes. It is involved in protein, nucleic acid, carbohydrate, and lipid metabolism, as well as in the control of gene transcription, growth, development, and differentiation. SLC39A6 belongs to a subfamily of proteins that show structural characteristics of zinc transporters.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using SLC39A6 antibody (70R-1720) | SLC39A6 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using SLC39A6 antibody (70R-1720) | SLC39A6 antibody (70R-1720) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
View Our Distributors