SLC4A1 antibody (70R-2370)

Rabbit polyclonal SLC4A1 antibody

Synonyms Polyclonal SLC4A1 antibody, Anti-SLC4A1 antibody, SLCA1-4, Solute Carrier Family 4 Anion Exchanger Member 1 antibody, SLCA1-4 antibody, SLCA1 4, SLCA1 4 antibody, Erythrocyte Membrane Protein Band 3 Diego Blood Group antibody, SLC4A1
Cross Reactivity Human
Applications WB
Immunogen SLC4A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PSQPLLPQHSSLETQLFCEQGDGGTEGHSPSGILEKIPPDSEATLVLVGR
Assay Information SLC4A1 Blocking Peptide, catalog no. 33R-7368, is also available for use as a blocking control in assays to test for specificity of this SLC4A1 antibody


Western Blot analysis using SLC4A1 antibody (70R-2370)

SLC4A1 antibody (70R-2370) used at 0.1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 102 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC4A1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The CD233 gene is located on chromosome 17q21-q22 and is part of the anion exchanger (AE) family. CD233 is expressed in the erythrocyte plasma membrane where it functions as a chloride/bicarbonate exchanger involved in carbon dioxide transport from tissues to lungs. The protein comprises two domains that are structurally and functionally distinct. The N-terminal 40 kDa domain is located in the cytoplasm and acts as an attachment site for the red cell skeleton by binding ankyrin. The glycosylated C-terminal membrane-associated domain contains 12-14 membrane spanning segments and carries out the stilbene disulphonate-sensitive exchange transport of anions. The cytoplasmic tail at the extreme C-terminus of the membrane domain binds carbonic anhydrase II. CD233 associates with the red cell membrane protein glycophorin A and this association promotes the correct folding and translocation of CD233.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SLC4A1 antibody (70R-2370) | SLC4A1 antibody (70R-2370) used at 0.1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
View Our Distributors