SLC7A8 antibody (70R-1792)

Rabbit polyclonal SLC7A8 antibody

Synonyms Polyclonal SLC7A8 antibody, Anti-SLC7A8 antibody, SLCA8-7, SLCA8-7 antibody, SLCA8 7, Solute Carrier Family 7 Member 8 antibody, SLCA8 7 antibody, Cationic Amino Acid Transporter Y+ System 8 antibody, LPI-PC1 antibody, SLC7A8, LAT2 antibody
Cross Reactivity Human, Mouse, Rat, Dog, ZebraFish
Applications WB
Immunogen SLC7A8 antibody was raised using a synthetic peptide corresponding to a region with amino acids PRAIFISIPLVTFVYVFANVAYVTAMSPQELLASNAVAVTFGEKLLGVMA
Assay Information SLC7A8 Blocking Peptide, catalog no. 33R-7317, is also available for use as a blocking control in assays to test for specificity of this SLC7A8 antibody


Western Blot analysis using SLC7A8 antibody (70R-1792)

SLC7A8 antibody (70R-1792) used at 1.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 37 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SLC7A8 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLC7A8 is sodium-independent, high-affinity transport of large neutral amino acids. It has higher affinity for L-phenylalanine than LAT1 but lower affinity for glutamine and serine. L-alanine is transported at physiological concentrations. SLC7A8 also plays a role in basolateral (re)absorption of neutral amino acids.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SLC7A8 antibody (70R-1792) | SLC7A8 antibody (70R-1792) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: €227.26
Size: 100 ug
View Our Distributors