Slc9a3r2 Blocking Peptide (33R-8058)
A synthetic peptide for use as a blocking control in assays to test for specificity of Slc9a3r2 antibody, catalog no. 70R-8580
Overview
Overview
| Synonyms | Slc9a3r2 control peptide, Slc9a3r2 antibody Blocking Peptide, Anti-Slc9a3r2 Blocking Peptide, solute carrier family 9, sodium/hydrogen exchanger, member 3 regulator 2 Blocking Peptide, E3karp Blocking Peptide, Slc9a3r2, Slca3r2-9, Slca3r2 9, Slca3r2-9 Blocking Peptide, Slca3r2 9 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | RLVRGEQGYGFHLHGEKGRRGQFIRRVEPGSPAEAAALRAGDRLVEVNGV |
|---|---|
| Molecular Weight | 37 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | Scaffold protein that connects plasma membrane proteins with members of the ezrin/moesin/radixin family and thereby helps to link them to the actin cytoskeleton and to regulate their surface expression. Slc9a3r2 is necessary for cAMP-mediated phosphorylation and inhibition of SLC9A3. It may also act as scaffold protein in the nucleus. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product