Slc9a3r2 Blocking Peptide (33R-8058)

A synthetic peptide for use as a blocking control in assays to test for specificity of Slc9a3r2 antibody, catalog no. 70R-8580

Synonyms Slc9a3r2 control peptide, Slc9a3r2 antibody Blocking Peptide, Anti-Slc9a3r2 Blocking Peptide, solute carrier family 9, sodium/hydrogen exchanger, member 3 regulator 2 Blocking Peptide, E3karp Blocking Peptide, Slc9a3r2, Slca3r2-9, Slca3r2 9, Slca3r2-9 Blocking Peptide, Slca3r2 9 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues RLVRGEQGYGFHLHGEKGRRGQFIRRVEPGSPAEAAALRAGDRLVEVNGV
Molecular Weight 37 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Scaffold protein that connects plasma membrane proteins with members of the ezrin/moesin/radixin family and thereby helps to link them to the actin cytoskeleton and to regulate their surface expression. Slc9a3r2 is necessary for cAMP-mediated phosphorylation and inhibition of SLC9A3. It may also act as scaffold protein in the nucleus.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors