SLFN12 antibody (70R-4360)

Rabbit polyclonal SLFN12 antibody raised against the N terminal of SLFN12

Synonyms Polyclonal SLFN12 antibody, Anti-SLFN12 antibody, FLJ10260 antibody, SLFN12, SLFN-12 antibody, SLFN 12 antibody, SLFN-12, SLFN 12, SLFN3 antibody, Schlafen Family Member 12 antibody
Specificity SLFN12 antibody was raised against the N terminal of SLFN12
Cross Reactivity Human
Applications WB
Immunogen SLFN12 antibody was raised using the N terminal of SLFN12 corresponding to a region with amino acids KLRKKQNESVSRAMCALLNSGGGVIKAEIENEDYSYTKDGIGLDLENSFS
Assay Information SLFN12 Blocking Peptide, catalog no. 33R-4534, is also available for use as a blocking control in assays to test for specificity of this SLFN12 antibody


Western Blot analysis using SLFN12 antibody (70R-4360)

SLFN12 antibody (70R-4360) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 67 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLFN12 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of SLFN12 protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SLFN12 antibody (70R-4360) | SLFN12 antibody (70R-4360) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors