SLIT3 Blocking Peptide (33R-7343)

A synthetic peptide for use as a blocking control in assays to test for specificity of SLIT3 antibody, catalog no. 70R-6057

Synonyms SLIT3 control peptide, SLIT3 antibody Blocking Peptide, Anti-SLIT3 Blocking Peptide, Slit Homolog 3 Blocking Peptide, FLJ10764 Blocking Peptide, MEGF5 Blocking Peptide, SLIL2 Blocking Peptide, SLIT1 Blocking Peptide, Slit-3 Blocking Peptide, slit2 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues PRRLANKRISQIKSKKFRCSGSEDYRSRFSSECFMDLVCPEKCRCEGTIV
Molecular Weight 168 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLIT3 may act as molecular guidance cue in cellular migration, and function may be mediated by interaction with roundabout homolog receptors.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors