SLIT3 Blocking Peptide (33R-7343)
A synthetic peptide for use as a blocking control in assays to test for specificity of SLIT3 antibody, catalog no. 70R-6057
Overview
Overview
| Synonyms | SLIT3 control peptide, SLIT3 antibody Blocking Peptide, Anti-SLIT3 Blocking Peptide, Slit Homolog 3 Blocking Peptide, FLJ10764 Blocking Peptide, MEGF5 Blocking Peptide, SLIL2 Blocking Peptide, SLIT1 Blocking Peptide, Slit-3 Blocking Peptide, slit2 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | PRRLANKRISQIKSKKFRCSGSEDYRSRFSSECFMDLVCPEKCRCEGTIV |
|---|---|
| Molecular Weight | 168 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | SLIT3 may act as molecular guidance cue in cellular migration, and function may be mediated by interaction with roundabout homolog receptors. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product