SMEK1 antibody (70R-4029)

Rabbit polyclonal SMEK1 antibody

Synonyms Polyclonal SMEK1 antibody, Anti-SMEK1 antibody, KIAA2010 antibody, Smek Homolog 1 Suppressor Of Mek1 antibody, SMEK-1, FLFL1 antibody, smk-1 antibody, SMEK 1 antibody, smk1 antibody, Dictyostelium antibody, SMEK1, MSTP033 antibody, SMEK-1 antibody, SMEK 1
Cross Reactivity Human
Applications WB
Immunogen SMEK1 antibody was raised using a synthetic peptide corresponding to a region with amino acids YWKALEDVDYVQTFKGLKLRFEQQRERQDNPKLDSMRSILRNHRYRRDAR
Assay Information SMEK1 Blocking Peptide, catalog no. 33R-10292, is also available for use as a blocking control in assays to test for specificity of this SMEK1 antibody


Western Blot analysis using SMEK1 antibody (70R-4029)

SMEK1 antibody (70R-4029) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 94 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SMEK1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SMEK1 is the regulatory subunit of serine/threonine-protein phosphatase 4.SMEK1 may regulate the activity of PPP4C at centrosomal microtubule organizing centers. The PPP4C-PPP4R2-PPP4R3A PP4 complex specifically dephosphorylates H2AFX phosphorylated on 'Ser-140' (gamma-H2AFX) generated during DNA replication and required for DNA DSB repair.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SMEK1 antibody (70R-4029) | SMEK1 antibody (70R-4029) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors