SMG5 antibody (70R-4235)

Rabbit polyclonal SMG5 antibody

Synonyms Polyclonal SMG5 antibody, Anti-SMG5 antibody, SMG-5 antibody, LPTSRP1 antibody, SMG 5, LPTS-RP1 antibody, RP11-54H19.7 antibody, SMG5, Smg-5 Homolog Nonsense Mediated mRNA Decay Factor antibody, FLJ34864 antibody, EST1B antibody, SMG-5, KIAA1089 antibody, SMG 5 antibody, SMG-5 antibody
Cross Reactivity Human
Applications WB
Immunogen SMG5 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSQGPPTGESSEPEAKVLHTKRLYRAVVEAVHRLDLILCNKTAYQEVFKP
Assay Information SMG5 Blocking Peptide, catalog no. 33R-6479, is also available for use as a blocking control in assays to test for specificity of this SMG5 antibody


Western Blot analysis using SMG5 antibody (70R-4235)

SMG5 antibody (70R-4235) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 114 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SMG5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SMG5 plays a role in nonsense-mediated mRNA decay. SMG5 does not have RNase activity by itself. SMG5 promotes dephosphorylation of RENT1. SMG5 is necessary for TERT activity.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SMG5 antibody (70R-4235) | SMG5 antibody (70R-4235) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors