SMPD2 Blocking Peptide (33R-8123)
A synthetic peptide for use as a blocking control in assays to test for specificity of SMPD2 antibody, catalog no. 70R-1809
Overview
Overview
| Synonyms | SMPD2 control peptide, SMPD2 antibody Blocking Peptide, Anti-SMPD2 Blocking Peptide, Sphingomyelin Phosphodiesterase 2 Neutral Membrane Blocking Peptide, Neutral Sphingomyelinase Blocking Peptide, NSMASE Blocking Peptide, SMPD2, SMPD-2, SMPD 2, SMPD-2 Blocking Peptide, SMPD 2 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | RQKLSPTYPAAHHFRSGIIGSGLCVFSKHPIQELTQHIYTLNGYPYMIHH |
|---|---|
| Molecular Weight | 48 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | SMPD2 converts sphingomyelin to ceramide. Hydrolyze 1-acyl-2-lyso-sn-glycero-3-phosphocholine (lyso-PC) and 1-O-alkyl-2-lyso-sn-glycero-3-phosphocholine (lyso-platelet-activating factor). The physiological substrate seems to be Lyso-PAF. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product