SMPD2 Blocking Peptide (33R-8123)

A synthetic peptide for use as a blocking control in assays to test for specificity of SMPD2 antibody, catalog no. 70R-1809

Synonyms SMPD2 control peptide, SMPD2 antibody Blocking Peptide, Anti-SMPD2 Blocking Peptide, Sphingomyelin Phosphodiesterase 2 Neutral Membrane Blocking Peptide, Neutral Sphingomyelinase Blocking Peptide, NSMASE Blocking Peptide, SMPD2, SMPD-2, SMPD 2, SMPD-2 Blocking Peptide, SMPD 2 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues RQKLSPTYPAAHHFRSGIIGSGLCVFSKHPIQELTQHIYTLNGYPYMIHH
Molecular Weight 48 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SMPD2 converts sphingomyelin to ceramide. Hydrolyze 1-acyl-2-lyso-sn-glycero-3-phosphocholine (lyso-PC) and 1-O-alkyl-2-lyso-sn-glycero-3-phosphocholine (lyso-platelet-activating factor). The physiological substrate seems to be Lyso-PAF.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors