SMPDL3B antibody (70R-5357)

Rabbit polyclonal SMPDL3B antibody raised against the N terminal of SMPDL3B

Synonyms Polyclonal SMPDL3B antibody, Anti-SMPDL3B antibody, Sphingomyelin Phosphodiesterase Acid-Like 3B antibody, SMPDLB 3 antibody, SMPDLB-3, SMPDLB 3, SMPDL3B, SMPDLB-3 antibody
Specificity SMPDL3B antibody was raised against the N terminal of SMPDL3B
Cross Reactivity Human
Applications IHC, WB
Immunogen SMPDL3B antibody was raised using the N terminal of SMPDL3B corresponding to a region with amino acids ILWTGDDTPHVPDEKLGEAAVLEIVERLTKLIREVFPDTKVYAALGNHDF
Assay Information SMPDL3B Blocking Peptide, catalog no. 33R-4064, is also available for use as a blocking control in assays to test for specificity of this SMPDL3B antibody

Images

Immunohistochemical staining using SMPDL3B antibody (70R-5357)

SMPDL3B antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of intestinal vilIus (arrows) in Human Intestine. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 52 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SMPDL3B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Located on chromosome 1, this gene encodes for acid sphingomyelinase-like phosphodiesterase 3b precursor protein.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using SMPDL3B antibody (70R-5357) | SMPDL3B antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of intestinal vilIus (arrows) in Human Intestine. Magnification is at 400X
  • Western Blot analysis using SMPDL3B antibody (70R-5357) | SMPDL3B antibody (70R-5357) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors