SMYD1 Blocking Peptide (33R-1045)
A synthetic peptide for use as a blocking control in assays to test for specificity of SMYD1 antibody, catalog no. 70R-9015
Overview
Overview
| Synonyms | SMYD1 control peptide, SMYD1 antibody Blocking Peptide, Anti-SMYD1 Blocking Peptide, SET and MYND domain containing 1 Blocking Peptide, BOP Blocking Peptide, ZMYND18 Blocking Peptide, ZMYND22 Blocking Peptide, SMYD1, SMYD-1, SMYD 1, SMYD-1 Blocking Peptide, SMYD 1 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | AARIMWRVEREGTGLTEGCLVSVDDLQNHVEHFGEEEQKDLRVDVDTFLQ |
|---|---|
| Molecular Weight | 56 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | SMYD1 acts as a transcriptional repressor. SMYD1 is essential for cardiomyocyte differentiation and cardiac morphogenesis. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product