SMYD1 Blocking Peptide (33R-1045)

A synthetic peptide for use as a blocking control in assays to test for specificity of SMYD1 antibody, catalog no. 70R-9015

Synonyms SMYD1 control peptide, SMYD1 antibody Blocking Peptide, Anti-SMYD1 Blocking Peptide, SET and MYND domain containing 1 Blocking Peptide, BOP Blocking Peptide, ZMYND18 Blocking Peptide, ZMYND22 Blocking Peptide, SMYD1, SMYD-1, SMYD 1, SMYD-1 Blocking Peptide, SMYD 1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues AARIMWRVEREGTGLTEGCLVSVDDLQNHVEHFGEEEQKDLRVDVDTFLQ
Molecular Weight 56 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SMYD1 acts as a transcriptional repressor. SMYD1 is essential for cardiomyocyte differentiation and cardiac morphogenesis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors