SNAP23 antibody (70R-2566)

Rabbit polyclonal SNAP23 antibody raised against the N terminal of SNAP23

Synonyms Polyclonal SNAP23 antibody, Anti-SNAP23 antibody, SNAP-23 antibody, SNAP 23 antibody, Synaptosomal-Associated Protein 23Kda antibody, SNAP23A antibody, SNAP23B antibody, SNAP-23, SNAP 23, SNAP23, HsT17016 antibody
Specificity SNAP23 antibody was raised against the N terminal of SNAP23
Cross Reactivity Human
Applications WB
Immunogen SNAP23 antibody was raised using the N terminal of SNAP23 corresponding to a region with amino acids GIKTITMLDEQKEQLNRIEEGLDQINKDMRETEKTLTELNKCCGLCVCPC
Assay Information SNAP23 Blocking Peptide, catalog no. 33R-3332, is also available for use as a blocking control in assays to test for specificity of this SNAP23 antibody

Western Blot analysis using SNAP23 antibody (70R-2566)

SNAP23 antibody (70R-2566) used at 1 ug/ml to detect target protein.

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 23 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SNAP23 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SNAP23 is structurally and functionally similar to SNAP25 and binds tightly to multiple syntaxins and synaptobrevins/VAMPs. It is an essential component of the high affinity receptor for the general membrane fusion machinery and is an important regulator of transport vesicle docking and fusion. Two alternative transcript variants encoding different protein isoforms have been described for this genepecificity of vesicular transport is regulated, in part, by the interaction of a vesicle-associated membrane protein termed synaptobrevin/VAMP with a target compartment membrane protein termed syntaxin.

Add a Paper

Sorry, but there are no references currently for this product.

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

  • Western Blot analysis using SNAP23 antibody (70R-2566) | SNAP23 antibody (70R-2566) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
View Our Distributors