Snap29 Blocking Peptide (33R-6878)

A synthetic peptide for use as a blocking control in assays to test for specificity of Snap29 antibody, catalog no. 70R-9803

Synonyms Snap29 control peptide, Snap29 antibody Blocking Peptide, Anti-Snap29 Blocking Peptide, synaptosomal-associated protein 29 Blocking Peptide, Gs32 Blocking Peptide, MGC105273 Blocking Peptide, Snap29, Snap-29, Snap 29, Snap-29 Blocking Peptide, Snap 29 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues NSIKSVFGGFINYFKSKPVEPPPEQNGSIVPQPSSRLKEAINTSKDQESK
Molecular Weight 29 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Snap29 binds with Snap25 to form complexin.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors