Snap29 Blocking Peptide (33R-6878)
A synthetic peptide for use as a blocking control in assays to test for specificity of Snap29 antibody, catalog no. 70R-9803
Overview
Overview
| Synonyms | Snap29 control peptide, Snap29 antibody Blocking Peptide, Anti-Snap29 Blocking Peptide, synaptosomal-associated protein 29 Blocking Peptide, Gs32 Blocking Peptide, MGC105273 Blocking Peptide, Snap29, Snap-29, Snap 29, Snap-29 Blocking Peptide, Snap 29 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | NSIKSVFGGFINYFKSKPVEPPPEQNGSIVPQPSSRLKEAINTSKDQESK |
|---|---|
| Molecular Weight | 29 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | Snap29 binds with Snap25 to form complexin. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product