SNRP70 antibody (70R-1431)

Rabbit polyclonal SNRP70 antibody

Synonyms Polyclonal SNRP70 antibody, Anti-SNRP70 antibody, SNRP70, SNRP 70, U1AP antibody, Rnp Antigen antibody, U170K antibody, SNRP 70 antibody, SNRP-70 antibody, RNPU1Z antibody, Small Nuclear Ribonucleoprotein 70Kda Polypeptide antibody, SNRP-70, U1RNP antibody, RPU1 antibody
Cross Reactivity Human,Mouse,Rat,Dog,ZebraFish
Applications IHC, WB
Immunogen SNRP70 antibody was raised using a synthetic peptide corresponding to a region with amino acids YLPPLEKLPHEKHHNQPYCGIAPYIREFEDPRDAPPPTRAETREERMERK
Assay Information SNRP70 Blocking Peptide, catalog no. 33R-10176, is also available for use as a blocking control in assays to test for specificity of this SNRP70 antibody

Images

Western Blot analysis using SNRP70 antibody (70R-1431)

SNRP70 antibody (70R-1431) used at 5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 48 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SNRP70 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SNRP70 contains 1 RRM (RNA recognition motif) domain and mediates the splicing of pre-mRNA by binding to the loop I region of U1-snRNA.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SNRP70 antibody (70R-1431) | SNRP70 antibody (70R-1431) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
OR
Shipping
View Our Distributors