SNRPA1 antibody (70R-1350)

Rabbit polyclonal SNRPA1 antibody raised against the C terminal of SNRPA1

Synonyms Polyclonal SNRPA1 antibody, Anti-SNRPA1 antibody, Small Nuclear Ribonucleoprotein Polypeptide A antibody
Specificity SNRPA1 antibody was raised against the C terminal of SNRPA1
Cross Reactivity Human,Dog
Applications IHC, WB
Immunogen SNRPA1 antibody was raised using the C terminal of SNRPA1 corresponding to a region with amino acids RRSKTFNPGAGLPTDKKKGGPSPGDVEAIKNAIANASTLAEVERLKGLLQ
Assay Information SNRPA1 Blocking Peptide, catalog no. 33R-8161, is also available for use as a blocking control in assays to test for specificity of this SNRPA1 antibody

Images

Western Blot analysis using SNRPA1 antibody (70R-1350)

SNRPA1 antibody (70R-1350) used at 2.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 18 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SNRPA1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SNRPA1 contains 3 LRR (leucine-rich) repeats and belongs to the U2 small nuclear ribonucleoprotein A family. It is associated with sn-RNP U2 and helps the A' protein to bind stem loop IV of U2 snRNA.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SNRPA1 antibody (70R-1350) | SNRPA1 antibody (70R-1350) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
OR
Shipping
View Our Distributors