SNRPB antibody (70R-4699)

Rabbit polyclonal SNRPB antibody raised against the N terminal of SNRPB

Synonyms Polyclonal SNRPB antibody, Anti-SNRPB antibody, SNRPB1 antibody, COD antibody, Small Nuclear Ribonucleoprotein Polypeptides B And B1 antibody, snRNP-B antibody, SmB/SmB' antibody
Specificity SNRPB antibody was raised against the N terminal of SNRPB
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen SNRPB antibody was raised using the N terminal of SNRPB corresponding to a region with amino acids DKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSMTVEG
Assay Information SNRPB Blocking Peptide, catalog no. 33R-2018, is also available for use as a blocking control in assays to test for specificity of this SNRPB antibody


Western Blot analysis using SNRPB antibody (70R-4699)

SNRPB antibody (70R-4699) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 24 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SNRPB antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SNRPB is one of several nuclear proteins that are found in common among U1, U2, U4/U6, and U5 small ribonucleoprotein particles (snRNPs). These snRNPs are involved in pre-mRNA splicing, and the encoded protein may also play a role in pre-mRNA splicing.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SNRPB antibody (70R-4699) | SNRPB antibody (70R-4699) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors