SNX5 antibody (70R-5748)

Rabbit polyclonal SNX5 antibody raised against the N terminal of SNX5

Synonyms Polyclonal SNX5 antibody, Anti-SNX5 antibody, Sorting Nexin 5 antibody, SNX 5, SNX-5, SNX5, SNX-5 antibody, FLJ10931 antibody, SNX 5 antibody
Specificity SNX5 antibody was raised against the N terminal of SNX5
Cross Reactivity Human,Mouse
Applications WB
Immunogen SNX5 antibody was raised using the N terminal of SNX5 corresponding to a region with amino acids FVWLHDTLIETTDYAGLIIPPAPTKPDFDGPREKMQKLGEGEGSMTKEEF
Assay Information SNX5 Blocking Peptide, catalog no. 33R-3126, is also available for use as a blocking control in assays to test for specificity of this SNX5 antibody

Images

Western Blot analysis using SNX5 antibody (70R-5748)

SNX5 antibody (70R-5748) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 47 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SNX5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SNX5 is a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein binds to fanconi anemia complementation group A protein, but its function is unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SNX5 antibody (70R-5748) | SNX5 antibody (70R-5748) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors