SNX7 antibody (70R-5795)

Rabbit polyclonal SNX7 antibody raised against the middle region of SNX7

Synonyms Polyclonal SNX7 antibody, Anti-SNX7 antibody, SNX-7 antibody, SNX-7, Sorting Nexin 7 antibody, MGC8717 antibody, SNX 7 antibody, SNX7, SNX 7, DKFZP564F052 antibody
Specificity SNX7 antibody was raised against the middle region of SNX7
Cross Reactivity Human
Applications WB
Immunogen SNX7 antibody was raised using the middle region of SNX7 corresponding to a region with amino acids LDSKVEVLTYKKADTDLLPEEIGKLEDKVECANNALKADWERWKQNMQND
Assay Information SNX7 Blocking Peptide, catalog no. 33R-4867, is also available for use as a blocking control in assays to test for specificity of this SNX7 antibody


Western Blot analysis using SNX7 antibody (70R-5795)

SNX7 antibody (70R-5795) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 45 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SNX7 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SNX7 antibody (70R-5795) | SNX7 antibody (70R-5795) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors