SOCS7 antibody (70R-5835)

Rabbit polyclonal SOCS7 antibody raised against the N terminal of SOCS7

Synonyms Polyclonal SOCS7 antibody, Anti-SOCS7 antibody, SOCS-7 antibody, SOCS7, SOCS 7, NAP4 antibody, SOCS-7, SOCS 7 antibody, Suppressor Of Cytokine Signaling 7 antibody
Specificity SOCS7 antibody was raised against the N terminal of SOCS7
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen SOCS7 antibody was raised using the N terminal of SOCS7 corresponding to a region with amino acids LDPKALPPGLALERTWGPAAGLEAQLAALGLGQPAGPGVKTVGGGCCPCP
Assay Information SOCS7 Blocking Peptide, catalog no. 33R-4853, is also available for use as a blocking control in assays to test for specificity of this SOCS7 antibody

Images

Western Blot analysis using SOCS7 antibody (70R-5835)

SOCS7 antibody (70R-5835) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 64 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SOCS7 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SOCS7 regulates signaling cascades probably through protein ubiquitination and/or sequestration. SOCS7 functions in insulin signaling and glucose homeostasis through IRS1 ubiquitination and subsequent proteasomal degradation. SOCS7 inhibits also prolactin, growth hormone and leptin signaling by preventing STAT3 and STAT5 activation, sequestering them in the cytoplasm and reducing their binding to DNA. SOCS7 may be a substrate recognition component of a SCF-like E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SOCS7 antibody (70R-5835) | SOCS7 antibody (70R-5835) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors