SOD2 antibody (70R-5749)

Rabbit polyclonal SOD2 antibody raised against the N terminal of SOD2

Synonyms Polyclonal SOD2 antibody, Anti-SOD2 antibody, MNSOD antibody, Superoxide Dismutase 2 Mitochondrial antibody, Mn-SOD antibody, IPO-B antibody
Specificity SOD2 antibody was raised against the N terminal of SOD2
Cross Reactivity Human
Applications WB
Immunogen SOD2 antibody was raised using the N terminal of SOD2 corresponding to a region with amino acids MLSRAVCGTSRQLAPVLGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLH
Assay Information SOD2 Blocking Peptide, catalog no. 33R-6219, is also available for use as a blocking control in assays to test for specificity of this SOD2 antibody

Images

Western Blot analysis using SOD2 antibody (70R-5749)

SOD2 antibody (70R-5749) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 24 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SOD2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SOD2 is a member of the iron/manganese superoxide dismutase family. SOD2 is a mitochondrial protein that forms a homotetramer and binds one manganese ion per subunit. This protein binds to the superoxide byproducts of oxidative phosphorylation and converts them to hydrogen peroxide and diatomic oxygen. Mutations in this gene encoding SOD2 have been associated with idiopathic cardiomyopathy (IDC), premature aging, sporadic motor neuron disease, and cancer.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SOD2 antibody (70R-5749) | SOD2 antibody (70R-5749) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors