SOHLH1 antibody (70R-3390)

Rabbit polyclonal SOHLH1 antibody raised against the middle region of SOHLH1

Synonyms Polyclonal SOHLH1 antibody, Anti-SOHLH1 antibody, SOHLH-1, SOHLH 1, bA100C15.3 antibody, NOHLH antibody, C9orf157 antibody, SOHLH 1 antibody, SOHLH-1 antibody, TEB2 antibody, Spermatogenesis And Oogenesis Specific Basic Helix-Loop-Helix 1 antibody, SOHLH1
Specificity SOHLH1 antibody was raised against the middle region of SOHLH1
Cross Reactivity Human
Applications WB
Immunogen SOHLH1 antibody was raised using the middle region of SOHLH1 corresponding to a region with amino acids EAAWLEGRIRQEFDKLREFLRVEEQAILDAMAEETRQKQLLADEKMKQLT
Assay Information SOHLH1 Blocking Peptide, catalog no. 33R-2251, is also available for use as a blocking control in assays to test for specificity of this SOHLH1 antibody

Images

Western Blot analysis using SOHLH1 antibody (70R-3390)

SOHLH1 antibody (70R-3390) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SOHLH1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SOHLH1 contains 1 basic helix-loop-helix (bHLH) domain. It is a probable transcription factor required during spermatogenesis and oogenesis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SOHLH1 antibody (70R-3390) | SOHLH1 antibody (70R-3390) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors