SPAG8 antibody (70R-2386)

Rabbit polyclonal SPAG8 antibody raised against the middle region of SPAG8

Synonyms Polyclonal SPAG8 antibody, Anti-SPAG8 antibody, SPAG 8 antibody, SPAG3 antibody, SPAG 8, SPAG8, MGC26201 antibody, SPAG-8 antibody, Sperm Associated Antigen 8 antibody, HSD-1 antibody, SPAG-8, BS-84 antibody, hSMP-1 antibody, SMP1 antibody
Specificity SPAG8 antibody was raised against the middle region of SPAG8
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen SPAG8 antibody was raised using the middle region of SPAG8 corresponding to a region with amino acids PAPTKPHDYRQEQPETFWIQRAPQLPTWWPLPTQVPAAEDYLTWKEWGFT
Assay Information SPAG8 Blocking Peptide, catalog no. 33R-6974, is also available for use as a blocking control in assays to test for specificity of this SPAG8 antibody

Images

Western Blot analysis using SPAG8 antibody (70R-2386)

SPAG8 antibody (70R-2386) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 53 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SPAG8 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The correlation of anti-sperm antibodies with cases of unexplained infertility implicates a role for these antibodies in blocking fertilization. Improved diagnosis and treatment of immunologic infertility, as well as identification of proteins for targeted contraception, are dependent on the identification and characterization of relevant sperm antigens. SPAG8 is recognised by sperm agglutinating antibodies from an infertile woman. This protein is localized in germ cells of the testis at all stages of spermatogenesis and is localized to the acrosomal region of mature spermatozoa.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SPAG8 antibody (70R-2386) | SPAG8 antibody (70R-2386) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors