SPDYA antibody (70R-2246)

Rabbit polyclonal SPDYA antibody

Synonyms Polyclonal SPDYA antibody, Anti-SPDYA antibody, SPDY1 antibody, Speedy Homolog A antibody, SPY1 antibody, MGC57218 antibody, MGC110856 antibody
Cross Reactivity Human
Applications WB
Immunogen SPDYA antibody was raised using a synthetic peptide corresponding to a region with amino acids MRHNQMCCETPPTVTVYVKSGSNRSHQPKKPITLKRPICKDNWQAFEKNT
Assay Information SPDYA Blocking Peptide, catalog no. 33R-6362, is also available for use as a blocking control in assays to test for specificity of this SPDYA antibody


Western Blot analysis using SPDYA antibody (70R-2246)

SPDYA antibody (70R-2246) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SPDYA antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SPDYA regulates the G1/S phase transition of the cell cycle by binding and activating CDC2, CDK2 and CDKN1B/KIP1. SPDYA can activate CDK2 without promoting CDK2 phosphorylation. SPDYA mediates cell survival during the DNA damage process through activation of CDK2.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SPDYA antibody (70R-2246) | SPDYA antibody (70R-2246) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
View Our Distributors