SPNS2 antibody (70R-2278)
Rabbit polyclonal SPNS2 antibody
Overview
Overview
Synonyms | Polyclonal SPNS2 antibody, Anti-SPNS2 antibody, Spinster Homolog 2 antibody, SPNS2, SPNS 2, SPNS 2 antibody, SPNS-2, SPNS-2 antibody |
---|---|
Cross Reactivity | Human |
Applications | WB |
Immunogen | SPNS2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PPGTPGTPGCAATAKGPGAQQPKPASLGRGRGAAAAILSLGNVLNYLDRY |
Assay Information | SPNS2 Blocking Peptide, catalog no. 33R-7255, is also available for use as a blocking control in assays to test for specificity of this SPNS2 antibody |
Images
Western blot analysis using SPNS2 antibody (70R-2278)
Recommended SPNS2 Antibody Titration: 0.2-1 ug/ml
Specifications
Host | Rabbit |
---|---|
Method of Purification | Affinity purified |
Molecular Weight | 60 kDa (MW of target protein) |
Form & Buffer | Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SPNS2 antibody in PBS |
Concentration | 1 mg/ml |
Usage & Assay Information
Usage Recommendations | WB: 1 ug/ml |
---|
Storage & Safety
Storage | Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles. |
---|
General Information
Biological Significance | SPNS2 is the sphingolipid transporter required for migration of myocardial precursors. SPNS2 transports sphingosine 1-phosphate (S1P), a secreted lipid mediator that plays critical roles in cardiovascular, immunological, and neural development and function. SPNS2 mediates the export of S1P from cells in the extraembryonic yolk syncytial layer (YSL), thereby regulating myocardial precursor migration. |
---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product