SPRED2 Blocking Peptide (33R-6713)
A synthetic peptide for use as a blocking control in assays to test for specificity of SPRED2 antibody, catalog no. 70R-10053
Overview
Overview
| Synonyms | SPRED2 control peptide, SPRED2 antibody Blocking Peptide, Anti-SPRED2 Blocking Peptide, sprouty-related, EVH1 domain containing 2 Blocking Peptide, FLJ21897 Blocking Peptide, FLJ31917 Blocking Peptide, MGC163164 Blocking Peptide, Spred-2 Blocking Peptide, SPRED2, SPRED-2, SPRED 2, SPRED-2 Blocking Peptide, SPRED 2 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | NHEENRRGHCQDAPDSVRTCIRRVSCMWCADSMLYHCMSDPEGDYTDPCS |
|---|---|
| Molecular Weight | 47 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | SPRED2 is a member of the Sprouty /SPRED family of proteins that regulate growth factor-induced activation of the MAP kinase cascade . |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product