SPRED2 Blocking Peptide (33R-6713)

A synthetic peptide for use as a blocking control in assays to test for specificity of SPRED2 antibody, catalog no. 70R-10053

Synonyms SPRED2 control peptide, SPRED2 antibody Blocking Peptide, Anti-SPRED2 Blocking Peptide, sprouty-related, EVH1 domain containing 2 Blocking Peptide, FLJ21897 Blocking Peptide, FLJ31917 Blocking Peptide, MGC163164 Blocking Peptide, Spred-2 Blocking Peptide, SPRED2, SPRED-2, SPRED 2, SPRED-2 Blocking Peptide, SPRED 2 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues NHEENRRGHCQDAPDSVRTCIRRVSCMWCADSMLYHCMSDPEGDYTDPCS
Molecular Weight 47 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SPRED2 is a member of the Sprouty /SPRED family of proteins that regulate growth factor-induced activation of the MAP kinase cascade .

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors