SQLE antibody (70R-1955)

Rabbit polyclonal SQLE antibody raised against the C terminal of SQLE

Synonyms Polyclonal SQLE antibody, Anti-SQLE antibody, FLJ30795 antibody, Squalene Epoxidase antibody
Specificity SQLE antibody was raised against the C terminal of SQLE
Cross Reactivity Human,Mouse
Applications IHC, WB
Immunogen SQLE antibody was raised using the C terminal of SQLE corresponding to a region with amino acids KKSFYWARKTSHSFVVNILAQALYELFSATDDSLHQLRKACFLYFKLGGE
Assay Information SQLE Blocking Peptide, catalog no. 33R-4493, is also available for use as a blocking control in assays to test for specificity of this SQLE antibody


Immunohistochemical staining using SQLE antibody (70R-1955)

SQLE antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SQLE antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Squalene epoxidase catalyzes the first oxygenation step in sterol biosynthesis and is thought to be one of the rate-limiting enzymes in this pathway.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using SQLE antibody (70R-1955) | SQLE antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using SQLE antibody (70R-1955) | SQLE antibody (70R-1955) used at 0.25 ug/ml to detect target protein.
  • Immunohistochemical staining using SQLE antibody (70R-1955) | SQLE antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Hepatocytes (arrows) in Human Liver. Magnification is at 400X

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors