SRA1 Blocking Peptide (33R-10399)

A synthetic peptide for use as a blocking control in assays to test for specificity of SRA1 antibody, catalog no. 70R-10353

Synonyms SRA1 control peptide, SRA1 antibody Blocking Peptide, Anti-SRA1 Blocking Peptide, steroid receptor RNA activator 1 Blocking Peptide, MGC87674 Blocking Peptide, SRA Blocking Peptide, SRAP Blocking Peptide, STRAA1 Blocking Peptide, pp7684 Blocking Peptide, SRA1, SRA-1, SRA 1, SRA-1 Blocking Peptide, SRA 1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues SGPASGVEPTSFPVESEAVMEDVLRPLEQALEDCRGHTRKQVCDDISRRL
Molecular Weight 26 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene is involved in transcriptional coactivation by steroid receptors. There is currently data suggesting this gene encodes both a non-coding RNA that functions as part of a ribonucleoprotein complex and a protein coding mRNA. Increased expression of both the transcript and the protein is associated with cancer.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €122.31
Size: 100 ug
OR
Shipping
View Our Distributors