SRD5A2 Blocking Peptide (33R-4423)

A synthetic peptide for use as a blocking control in assays to test for specificity of SRD5A2 antibody, catalog no. 70R-6434

Synonyms SRD5A2 control peptide, SRD5A2 antibody Blocking Peptide, Anti-SRD5A2 Blocking Peptide, Steroid-5-Alpha-Reductase Alpha Polypeptide 2 Blocking Peptide, 3-Oxo-5 Alpha-Steroid Delta 4-Dehydrogenase Alpha 2 Blocking Peptide, MGC138457 Blocking Peptide, SRD5A2, SRDA2-5, SRDA2 5, SRDA2-5 Blocking Peptide, SRDA2 5 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues KHTESLKPAATRLPARAAWFLQELPSFAVPAGILARQPLSLFGPPGTVLL
Molecular Weight 28 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a microsomal protein expressed at high levels in androgen-sensitive tissues such as the prostate. The encoded protein is active at acidic pH and is sensitive to the 4-azasteroid inhibitor finasteride. Deficiencies in this gene can result in male pseudohermaphroditism, specifically pseudovaginal perineoscrotal hypospadias (PPSH).

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors