SRD5A2 Blocking Peptide (33R-4423)
A synthetic peptide for use as a blocking control in assays to test for specificity of SRD5A2 antibody, catalog no. 70R-6434
Overview
Overview
| Synonyms | SRD5A2 control peptide, SRD5A2 antibody Blocking Peptide, Anti-SRD5A2 Blocking Peptide, Steroid-5-Alpha-Reductase Alpha Polypeptide 2 Blocking Peptide, 3-Oxo-5 Alpha-Steroid Delta 4-Dehydrogenase Alpha 2 Blocking Peptide, MGC138457 Blocking Peptide, SRD5A2, SRDA2-5, SRDA2 5, SRDA2-5 Blocking Peptide, SRDA2 5 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | KHTESLKPAATRLPARAAWFLQELPSFAVPAGILARQPLSLFGPPGTVLL |
|---|---|
| Molecular Weight | 28 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | This gene encodes a microsomal protein expressed at high levels in androgen-sensitive tissues such as the prostate. The encoded protein is active at acidic pH and is sensitive to the 4-azasteroid inhibitor finasteride. Deficiencies in this gene can result in male pseudohermaphroditism, specifically pseudovaginal perineoscrotal hypospadias (PPSH). |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product