SRD5A3 Blocking Peptide (33R-3408)
A synthetic peptide for use as a blocking control in assays to test for specificity of SRD5A3 antibody, catalog no. 70R-7438
Overview
Overview
| Synonyms | SRD5A3 control peptide, SRD5A3 antibody Blocking Peptide, Anti-SRD5A3 Blocking Peptide, Steroid 5 Alpha-Reductase 3 Blocking Peptide, FLJ13352 Blocking Peptide, SRD5A2L Blocking Peptide, SRD5A3, SRDA3-5, SRDA3 5, SRDA3-5 Blocking Peptide, SRDA3 5 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | GLLPGCAIFQDLIRYGKTKCGEPSRPAACRAFDVPKRYFSHFYIISVLWN |
|---|---|
| Molecular Weight | 36 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | SRD5A3 belongs to the steroid 5-alpha reductase family and converts testosterone (T) into 5-alpha-dihydrotestosterone (DHT). |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product