SRD5A3 Blocking Peptide (33R-3408)

A synthetic peptide for use as a blocking control in assays to test for specificity of SRD5A3 antibody, catalog no. 70R-7438

Synonyms SRD5A3 control peptide, SRD5A3 antibody Blocking Peptide, Anti-SRD5A3 Blocking Peptide, Steroid 5 Alpha-Reductase 3 Blocking Peptide, FLJ13352 Blocking Peptide, SRD5A2L Blocking Peptide, SRD5A3, SRDA3-5, SRDA3 5, SRDA3-5 Blocking Peptide, SRDA3 5 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues GLLPGCAIFQDLIRYGKTKCGEPSRPAACRAFDVPKRYFSHFYIISVLWN
Molecular Weight 36 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SRD5A3 belongs to the steroid 5-alpha reductase family and converts testosterone (T) into 5-alpha-dihydrotestosterone (DHT).

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors