SRP19 antibody (70R-1410)

Rabbit polyclonal SRP19 antibody raised against the middle region of SRP19

Synonyms Polyclonal SRP19 antibody, Anti-SRP19 antibody, SRP19, SRP-19, SRP 19, SRP-19 antibody, Signal Recognition Particle 19Kda antibody, SRP 19 antibody
Specificity SRP19 antibody was raised against the middle region of SRP19
Cross Reactivity Human
Applications IHC, WB
Immunogen SRP19 antibody was raised using the middle region of SRP19 corresponding to a region with amino acids LCLVQFPSRKSVMLYAAEMIPKLKTRTQKTGGADQSLQQGEGSKKGKGKK
Assay Information SRP19 Blocking Peptide, catalog no. 33R-4826, is also available for use as a blocking control in assays to test for specificity of this SRP19 antibody

Images

Immunohistochemical staining using SRP19 antibody (70R-1410)

SRP19 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Squamous epithelial cells (arrows) in Human Skin. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 16 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SRP19 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SRP19 belongs to the SRP19 family. It is signal-recognition-particle assembly and binds directly to 7S RNA and mediates binding of the 54 kDa subunit of the SRP.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using SRP19 antibody (70R-1410) | SRP19 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Squamous epithelial cells (arrows) in Human Skin. Magnification is at 400X
  • Western Blot analysis using SRP19 antibody (70R-1410) | SRP19 antibody (70R-1410) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
OR
Shipping
View Our Distributors