SRP54 antibody (70R-4849)

Rabbit polyclonal SRP54 antibody raised against the middle region of SRP54

Synonyms Polyclonal SRP54 antibody, Anti-SRP54 antibody, SRP54, SRP-54, Signal Recognition Particle 54Kda antibody, SRP 54, SRP 54 antibody, SRP-54 antibody
Specificity SRP54 antibody was raised against the middle region of SRP54
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen SRP54 antibody was raised using the middle region of SRP54 corresponding to a region with amino acids ENFEIIIVDTSGRHKQEDSLFEEMLQVANAIQPDNIVYVMDASIGQACEA
Assay Information SRP54 Blocking Peptide, catalog no. 33R-2603, is also available for use as a blocking control in assays to test for specificity of this SRP54 antibody

Images

Western Blot analysis using SRP54 antibody (70R-4849)

SRP54 antibody (70R-4849) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 56 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SRP54 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SRP54 belongs to the GTP-binding SRP family. It binds to the signal sequence of presecretory protein when they emerge from the ribosomes and transfers them to TRAM (translocating chain-associating membrane protein).

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SRP54 antibody (70R-4849) | SRP54 antibody (70R-4849) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors