SRPRB antibody (70R-1768)

Rabbit polyclonal SRPRB antibody raised against the C terminal of SRPRB

Synonyms Polyclonal SRPRB antibody, Anti-SRPRB antibody, APMCF1 antibody, Signal Recognition Particle Receptor B Subunit antibody
Specificity SRPRB antibody was raised against the C terminal of SRPRB
Cross Reactivity Human
Applications WB
Immunogen SRPRB antibody was raised using the C terminal of SRPRB corresponding to a region with amino acids APAQLGKKGKEFEFSQLPLKVEFLECSAKGGRGDVGSADIQDLEKWLAKI
Assay Information SRPRB Blocking Peptide, catalog no. 33R-1415, is also available for use as a blocking control in assays to test for specificity of this SRPRB antibody


Western Blot analysis using SRPRB antibody (70R-1768)

SRPRB antibody (70R-1768) used at 5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 30 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SRPRB antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SRPRB has similarity to mouse protein which is a subunit of the signal recognition particle receptor (SR). This subunit is a transmembrane GTPase belonging to the GTPase superfamily. It anchors alpha subunit, a peripheral membrane GTPase, to the ER membrane. SR is required for the cotranslational targeting of both secretory and membrane proteins to the ER membrane.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SRPRB antibody (70R-1768) | SRPRB antibody (70R-1768) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
View Our Distributors