ST14 antibody (70R-3613)

Rabbit polyclonal ST14 antibody

Synonyms Polyclonal ST14 antibody, Anti-ST14 antibody, Colon Carcinoma antibody, ST 14, HAI antibody, ST-14, TADG-15 antibody, PRSS14 antibody, SNC19 antibody, MTSP1 antibody, ST-14 antibody, Suppression Of Tumorigenicity 14 antibody, MTSP-1 antibody, ST14, MT-SP1 antibody, ST 14 antibody
Cross Reactivity Human,Mouse,Rat
Applications IHC, WB
Immunogen ST14 antibody was raised using a synthetic peptide corresponding to a region with amino acids SHVFPAGKAIWVTGWGHTQYGGTGALILQKGEIRVINQTTCENLLPQQIT
Assay Information ST14 Blocking Peptide, catalog no. 33R-8520, is also available for use as a blocking control in assays to test for specificity of this ST14 antibody


Immunohistochemical staining using ST14 antibody (70R-3613)

ST14 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 46 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ST14 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ST14 is an epithelial-derived, integral membrane serine protease. This protease forms a complex with the Kunitz-type serine protease inhibitor, HAI-1, and is found to be activated by sphingosine 1-phosphate. This protease has been shown to cleave and activate hepatocyte growth factor/scattering factor, and urokinase plasminogen activator, which suggest the function of this protease as an epithelial membrane activator for other proteases and latent growth factors. The expression of this protease has been associated with breast, colon, prostate, and ovarian tumors, which implicates its role in cancer invasion, and metastasis.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using ST14 antibody (70R-3613) | ST14 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using ST14 antibody (70R-3613) | ST14 antibody (70R-3613) used at 0.25 ug/ml to detect target protein.
  • Immunohistochemical staining using ST14 antibody (70R-3613) | ST14 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors