ST14 Blocking Peptide (33R-7953)

A synthetic peptide for use as a blocking control in assays to test for specificity of ST14 antibody, catalog no. 70R-3612

Synonyms ST14 control peptide, ST14 antibody Blocking Peptide, Anti-ST14 Blocking Peptide, Suppression Of Tumorigenicity 14 Blocking Peptide, Colon Carcinoma Blocking Peptide, HAI Blocking Peptide, MT-SP1 Blocking Peptide, MTSP-1 Blocking Peptide, MTSP1 Blocking Peptide, PRSS14 Blocking Peptide, SNC19 Blocking Peptide, TADG-15 Blocking Peptide, ST14, ST-14, ST 14, ST-14 Blocking Peptide, ST 14 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues RHPGFEATFFQLPRMSSCGGRLRKAQGTFNSPYYPGHYPPNIDCTWNIEV
Molecular Weight 95 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ST14 is an epithelial-derived, integral membrane serine protease. This protease forms a complex with the Kunitz-type serine protease inhibitor, HAI-1, and is found to be activated by sphingosine 1-phosphate. This protease has been shown to cleave and activate hepatocyte growth factor/scattering factor, and urokinase plasminogen activator, which suggest the function of this protease as an epithelial membrane activator for other proteases and latent growth factors. The expression of this protease has been associated with breast, colon, prostate, and ovarian tumors, which implicates its role in cancer invasion, and metastasis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors