ST3GAL2 Blocking Peptide (33R-1106)

A synthetic peptide for use as a blocking control in assays to test for specificity of ST3GAL2 antibody, catalog no. 70R-7396

Synonyms ST3GAL2 control peptide, ST3GAL2 antibody Blocking Peptide, Anti-ST3GAL2 Blocking Peptide, St3 Beta-Galactoside Alpha-23-Sialyltransferase 2 Blocking Peptide, Gal-NAc6S Blocking Peptide, SIAT4B Blocking Peptide, ST3GALII Blocking Peptide, ST3GalA.2 Blocking Peptide, ST3GAL2, STGAL2-3, STGAL2 3, STGAL2-3 Blocking Peptide, STGAL2 3 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues ADSRGNWHHYWENNRYAGEFRKTGVHDADFEAHIIDMLAKASKIEVYRGN
Molecular Weight 40 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ST3GAL2 is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The protein is normally found in the Golgi but can be proteolytically processed to a soluble form. This protein, which is a member of glycosyltransferase family 29, can use the same acceptor substrates as does sialyltransferase 4A.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors