ST3GAL2 Blocking Peptide (33R-1106)
A synthetic peptide for use as a blocking control in assays to test for specificity of ST3GAL2 antibody, catalog no. 70R-7396
Overview
Overview
| Synonyms | ST3GAL2 control peptide, ST3GAL2 antibody Blocking Peptide, Anti-ST3GAL2 Blocking Peptide, St3 Beta-Galactoside Alpha-23-Sialyltransferase 2 Blocking Peptide, Gal-NAc6S Blocking Peptide, SIAT4B Blocking Peptide, ST3GALII Blocking Peptide, ST3GalA.2 Blocking Peptide, ST3GAL2, STGAL2-3, STGAL2 3, STGAL2-3 Blocking Peptide, STGAL2 3 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | ADSRGNWHHYWENNRYAGEFRKTGVHDADFEAHIIDMLAKASKIEVYRGN |
|---|---|
| Molecular Weight | 40 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | ST3GAL2 is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The protein is normally found in the Golgi but can be proteolytically processed to a soluble form. This protein, which is a member of glycosyltransferase family 29, can use the same acceptor substrates as does sialyltransferase 4A. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product