ST6GALNAC5 Blocking Peptide (33R-1167)
A synthetic peptide for use as a blocking control in assays to test for specificity of ST6GALNAC5 antibody, catalog no. 70R-1903
Overview
Overview
| Synonyms | ST6GALNAC5 control peptide, ST6GALNAC5 antibody Blocking Peptide, Anti-ST6GALNAC5 Blocking Peptide, St6 -N-Acetylgalactosaminide Alpha-26-Sialyltransferase 5 Blocking Peptide, MGC3184 Blocking Peptide, SIAT7E Blocking Peptide, ST6GalNAcV Blocking Peptide, ST6GALNAC5, STGALNAC5-6, STGALNAC5 6, STGALNAC5-6 Blocking Peptide, STGALNAC5 6 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | AFMITRHKMLQFDELFKQETGKDRKISNTWLSTGWFTMTIALELCDRINV |
|---|---|
| Molecular Weight | 38 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | ST6GALNAC5 belongs to a family of sialyltransferases that modify proteins and ceramides on the cell surface to alter cell-cell or cell-extracellular matrix interactions. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product