ST6GALNAC5 Blocking Peptide (33R-1167)

A synthetic peptide for use as a blocking control in assays to test for specificity of ST6GALNAC5 antibody, catalog no. 70R-1903

Synonyms ST6GALNAC5 control peptide, ST6GALNAC5 antibody Blocking Peptide, Anti-ST6GALNAC5 Blocking Peptide, St6 -N-Acetylgalactosaminide Alpha-26-Sialyltransferase 5 Blocking Peptide, MGC3184 Blocking Peptide, SIAT7E Blocking Peptide, ST6GalNAcV Blocking Peptide, ST6GALNAC5, STGALNAC5-6, STGALNAC5 6, STGALNAC5-6 Blocking Peptide, STGALNAC5 6 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues AFMITRHKMLQFDELFKQETGKDRKISNTWLSTGWFTMTIALELCDRINV
Molecular Weight 38 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ST6GALNAC5 belongs to a family of sialyltransferases that modify proteins and ceramides on the cell surface to alter cell-cell or cell-extracellular matrix interactions.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors