STAMBP Blocking Peptide (33R-8355)
A synthetic peptide for use as a blocking control in assays to test for specificity of STAMBP antibody, catalog no. 70R-5741
Overview
Overview
| Synonyms | STAMBP control peptide, STAMBP antibody Blocking Peptide, Anti-STAMBP Blocking Peptide, Stam Binding Protein Blocking Peptide, AMSH Blocking Peptide, MGC126516 Blocking Peptide, MGC126518 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | SDHGDVSLPPEDRVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIYS |
|---|---|
| Molecular Weight | 48 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | Cytokine-mediated signal transduction in the JAK-STAT cascade requires the involvement of adaptor molecules. One such signal-transducing adaptor molecule contains an SH3 domain that is required for induction of MYC and cell growth. STAMBP binds to the SH3 domain of the signal-transducing adaptor molecule, and plays a critical role in cytokine-mediated signaling for MYC induction and cell cycle progression. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product