STAMBP Blocking Peptide (33R-8355)

A synthetic peptide for use as a blocking control in assays to test for specificity of STAMBP antibody, catalog no. 70R-5741

Synonyms STAMBP control peptide, STAMBP antibody Blocking Peptide, Anti-STAMBP Blocking Peptide, Stam Binding Protein Blocking Peptide, AMSH Blocking Peptide, MGC126516 Blocking Peptide, MGC126518 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues SDHGDVSLPPEDRVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIYS
Molecular Weight 48 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Cytokine-mediated signal transduction in the JAK-STAT cascade requires the involvement of adaptor molecules. One such signal-transducing adaptor molecule contains an SH3 domain that is required for induction of MYC and cell growth. STAMBP binds to the SH3 domain of the signal-transducing adaptor molecule, and plays a critical role in cytokine-mediated signaling for MYC induction and cell cycle progression.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors