STAU1 antibody (70R-1433)

Rabbit polyclonal STAU1 antibody

Synonyms Polyclonal STAU1 antibody, Anti-STAU1 antibody, STAU 1, STAU-1 antibody, Staufen Rna Binding Protein Homolog 1 antibody, STAU-1, STAU1, STAU 1 antibody
Cross Reactivity Human,Rat
Applications IHC, WB
Immunogen STAU1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LSVGGQQFNGKGKTRQAAKHDAAAKALRILQNEPLPERLEVNGRESEEEN
Assay Information STAU1 Blocking Peptide, catalog no. 33R-5465, is also available for use as a blocking control in assays to test for specificity of this STAU1 antibody


Immunohistochemical staining using STAU1 antibody (70R-1433)

STAU1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of intestinal villus (arrows) in Human Intestine. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 63 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of STAU1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance STAU1(Staufen) is a member of the family of double-stranded RNA (dsRNA)-binding proteins involved in the transport and/or localization of mRNAs to different subcellular compartments and/or organelles. These proteins are characterized by the presence of multiple dsRNA-binding domains which are required to bind RNAs having double-stranded secondary structures.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using STAU1 antibody (70R-1433) | STAU1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of intestinal villus (arrows) in Human Intestine. Magnification is at 400X
  • Western Blot analysis using STAU1 antibody (70R-1433) | STAU1 antibody (70R-1433) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
View Our Distributors