STK39 antibody (70R-2693)

Rabbit polyclonal STK39 antibody

Synonyms Polyclonal STK39 antibody, Anti-STK39 antibody, STK 39, STK-39, Serine Threonine Kinase 39 antibody, STK39, STK-39 antibody, DCHT antibody, DKFZp686K05124 antibody, SPAK antibody, STK 39 antibody, PASK antibody, Ste20/Sps1 Homolog Yeast antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen STK39 antibody was raised using a synthetic peptide corresponding to a region with amino acids CAVNLVLRLRNSRKELNDIRFEFTPGRDTADGVSQELFSAGLVDGHDVVI
Assay Information STK39 Blocking Peptide, catalog no. 33R-1647, is also available for use as a blocking control in assays to test for specificity of this STK39 antibody

Western blot analysis using STK39 antibody (70R-2693)

Recommended STK39 Antibody Titration: 0.2-1 ug/ml

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 59 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of STK39 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance STK39 is a serine/threonine kinase that is thought to function in the cellular stress response pathway. The kinase is activated in response to hypotonic stress, leading to phosphorylation of several cation-chloride-coupled cotransporters. The catalytically active kinase specifically activates the p38 MAP kinase pathway, and its interaction with p38 decreases upon cellular stress, suggesting that this kinase may serve as an intermediate in the response to cellular stress.

Add a Paper

Sorry, but there are no references currently for this product.

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

  • Western blot analysis using STK39 antibody (70R-2693) | Recommended STK39 Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: €324.59
Size: 50 ug
View Our Distributors