STOML3 Blocking Peptide (33R-8431)
A synthetic peptide for use as a blocking control in assays to test for specificity of STOML3 antibody, catalog no. 70R-7076
Overview
Overview
| Synonyms | STOML3 control peptide, STOML3 antibody Blocking Peptide, Anti-STOML3 Blocking Peptide, Stomatin like 3 Blocking Peptide, Epb72-Like 3 Blocking Peptide, Epb7.2l Blocking Peptide, SRO Blocking Peptide, STOML3, STOML-3, STOML 3, STOML-3 Blocking Peptide, STOML 3 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | SFLLVIITFPISIWMCLKIIKEYERAVVFRLGRIQADKAKGPGLILVLPC |
|---|---|
| Molecular Weight | 32 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | The function of STOML3 protein is not widely studied, and is yet to be elucidated fully. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product