STRBP antibody (70R-4768)

Rabbit polyclonal STRBP antibody raised against the middle region of STRBP

Synonyms Polyclonal STRBP antibody, Anti-STRBP antibody, FLJ14984 antibody, DKFZp434N214 antibody, p74 antibody, FLJ14223 antibody, SPNR antibody, MGC3405 antibody, Spermatid Perinuclear Rna Binding Protein antibody, FLJ11307 antibody, MGC21529 antibody
Specificity STRBP antibody was raised against the middle region of STRBP
Cross Reactivity Human
Applications WB
Immunogen STRBP antibody was raised using the middle region of STRBP corresponding to a region with amino acids PSKKTAKLHVAVKVLQAMGYPTGFDADIECMSSDEKSDNESKNETVSSNS
Assay Information STRBP Blocking Peptide, catalog no. 33R-7353, is also available for use as a blocking control in assays to test for specificity of this STRBP antibody

Images

Western Blot analysis using STRBP antibody (70R-4768)

STRBP antibody (70R-4768) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 74 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of STRBP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance STRBP contains 2 DRBM (double-stranded RNA-binding) domains and 1 DZF domain. STRBP is involved in spermatogenesis and sperm function. It plays a role in regulation of cell growth.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using STRBP antibody (70R-4768) | STRBP antibody (70R-4768) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors