STS Blocking Peptide (33R-2652)
A synthetic peptide for use as a blocking control in assays to test for specificity of STS antibody, catalog no. 70R-7512
Overview
Overview
| Synonyms | STS control peptide, STS antibody Blocking Peptide, Anti-STS Blocking Peptide, Steroid Sulfatase Blocking Peptide, Microsomal Isozyme S Blocking Peptide, ARSC Blocking Peptide, ARSC1 Blocking Peptide, ASC Blocking Peptide, ES Blocking Peptide, SSDD Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | EPTSNMDIFPTVAKLAGAPLPEDRIIDGRDLMPLLEGKSQRSDHEFLFHY |
|---|---|
| Molecular Weight | 63 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | STS catalyzes the conversion of sulfated steroid precursors to estrogens during pregnancy. The protein is found in the endoplasmic reticulum, where it acts as a homodimer. Mutations in its gene are known to cause X-linked ichthyosis. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product