STS Blocking Peptide (33R-2652)

A synthetic peptide for use as a blocking control in assays to test for specificity of STS antibody, catalog no. 70R-7512

Synonyms STS control peptide, STS antibody Blocking Peptide, Anti-STS Blocking Peptide, Steroid Sulfatase Blocking Peptide, Microsomal Isozyme S Blocking Peptide, ARSC Blocking Peptide, ARSC1 Blocking Peptide, ASC Blocking Peptide, ES Blocking Peptide, SSDD Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues EPTSNMDIFPTVAKLAGAPLPEDRIIDGRDLMPLLEGKSQRSDHEFLFHY
Molecular Weight 63 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance STS catalyzes the conversion of sulfated steroid precursors to estrogens during pregnancy. The protein is found in the endoplasmic reticulum, where it acts as a homodimer. Mutations in its gene are known to cause X-linked ichthyosis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors