SULT1A1 antibody (70R-2618)

Rabbit polyclonal SULT1A1 antibody raised against the N terminal of SULT1A1

Synonyms Polyclonal SULT1A1 antibody, Anti-SULT1A1 antibody, SULTA-1 antibody, Sulfotransferase Family Cytosolic 1A Phenol-Preferring Member 1 antibody, PST antibody, STP antibody, STP1 antibody, SULTA 1 antibody, MGC5163 antibody, P-PST antibody, SULT1A1, ST1A3 antibody, MGC131921 antibody, SULTA 1, TSPST1 antibody, SULTA-1, HAST1/HAST2 antibody
Specificity SULT1A1 antibody was raised against the N terminal of SULT1A1
Cross Reactivity Human
Applications WB
Immunogen SULT1A1 antibody was raised using the N terminal of SULT1A1 corresponding to a region with amino acids ELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGT
Assay Information SULT1A1 Blocking Peptide, catalog no. 33R-2553, is also available for use as a blocking control in assays to test for specificity of this SULT1A1 antibody

Images

Western Blot analysis using SULT1A1 antibody (70R-2618)

SULT1A1 antibody (70R-2618) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 34 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SULT1A1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. SULT1A1 is one of two phenol sulfotransferases with thermostable enzyme activity.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SULT1A1 antibody (70R-2618) | SULT1A1 antibody (70R-2618) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors