SULT1B1 antibody (70R-2335)

Rabbit polyclonal SULT1B1 antibody raised against the N terminal of SULT1B1

Synonyms Polyclonal SULT1B1 antibody, Anti-SULT1B1 antibody, SULTB-1, SULTB-1 antibody, Sulfotransferase Family Cytosolic 1B Member 1 antibody, ST1B2 antibody, SULT1B2 antibody, SULTB 1 antibody, MGC13356 antibody, SULTB 1, SULT1B1
Specificity SULT1B1 antibody was raised against the N terminal of SULT1B1
Cross Reactivity Human,Dog
Applications WB
Immunogen SULT1B1 antibody was raised using the N terminal of SULT1B1 corresponding to a region with amino acids KRGFITEKVPMLEMTLPGLRTSGIEQLEKNPSPRIVKTHLPTDLLPKSFW
Assay Information SULT1B1 Blocking Peptide, catalog no. 33R-4623, is also available for use as a blocking control in assays to test for specificity of this SULT1B1 antibody


Western Blot analysis using SULT1B1 antibody (70R-2335)

SULT1B1 antibody (70R-2335) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 35 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SULT1B1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SULT1B1 Catalyzes the sulfate conjugation of many hormones, neurotransmitters, drugs and xenobiotic compounds. Sulfonation increases the water solubility of most compounds, and therefore their renal excretion, but it can also result in bioactivation to form active metabolites. Sulfates dopamine, small phenols such as 1-naphthol and p-nitrophenol and thyroid hormones, including 3,3'-diiodothyronine, triidothyronine, reverse triiodothyronine and thyroxine.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SULT1B1 antibody (70R-2335) | SULT1B1 antibody (70R-2335) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
View Our Distributors