SULT1C4 antibody (70R-2015)

Rabbit polyclonal SULT1C4 antibody raised against the middle region of SULT1C4

Synonyms Polyclonal SULT1C4 antibody, Anti-SULT1C4 antibody, SULT1C antibody, SULT1C4, SULTC4 1, SULT1C2 antibody, MGC149521 antibody, Sulfotransferase Family Cytosolic 1C Member 4 antibody, SULTC4-1 antibody, MGC34422 antibody, SULTC4-1, SULTC4 1 antibody
Specificity SULT1C4 antibody was raised against the middle region of SULT1C4
Cross Reactivity Human
Applications WB
Immunogen SULT1C4 antibody was raised using the middle region of SULT1C4 corresponding to a region with amino acids HEHVKGWWEAKDKHRILYLFYEDMKKNPKHEIQKLAEFIGKKLDDKVLDK
Assay Information SULT1C4 Blocking Peptide, catalog no. 33R-3718, is also available for use as a blocking control in assays to test for specificity of this SULT1C4 antibody


Western Blot analysis using SULT1C4 antibody (70R-2015)

SULT1C4 antibody (70R-2015) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 35 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SULT1C4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SULT1C4 catalyzes the sulfate conjugation of many drugs, xenobiotic compounds, hormones, and neurotransmitters. It may be involved in the activation of carcinogenic hyroxylamines. SULT1C4 shows activity towards p-nitrophenol and N-hydroxy-2-acetylamino-fluorene (N-OH-2AAF).Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SULT1C4 antibody (70R-2015) | SULT1C4 antibody (70R-2015) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
View Our Distributors