SULT2B1 antibody (70R-2605)

Rabbit polyclonal SULT2B1 antibody raised against the middle region of SULT2B1

Synonyms Polyclonal SULT2B1 antibody, Anti-SULT2B1 antibody, SULTB1-2, HSST2 antibody, SULTB1 2, SULTB1-2 antibody, SULT2B1, Sulfotransferase Family Cytosolic 2B Member 1 antibody, SULTB1 2 antibody
Specificity SULT2B1 antibody was raised against the middle region of SULT2B1
Cross Reactivity Human,Mouse
Applications WB
Immunogen SULT2B1 antibody was raised using the middle region of SULT2B1 corresponding to a region with amino acids YSKIAGQLKDPGTPDQFLRDFLKGEVQFGSWFDHIKGWLRMKGKDNFLFI
Assay Information SULT2B1 Blocking Peptide, catalog no. 33R-10242, is also available for use as a blocking control in assays to test for specificity of this SULT2B1 antibody


Western Blot analysis using SULT2B1 antibody (70R-2605)

SULT2B1 antibody (70R-2605) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SULT2B1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene sulfates dehydroepiandrosterone but not 4-nitrophenol, a typical substrate for the phenol and estrogen sulfotransferase subfamilies.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SULT2B1 antibody (70R-2605) | SULT2B1 antibody (70R-2605) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors