SUMO3 antibody (70R-3146)

Rabbit polyclonal SUMO3 antibody

Synonyms Polyclonal SUMO3 antibody, Anti-SUMO3 antibody, Smt3 Suppressor Of Mif Two 3 Homolog 3 antibody, SUMO-3 antibody, SUMO 3, SMT3A antibody, SUMO-3, SMT3H1 antibody, SUMO3, SUMO 3 antibody, SUMO-3 antibody
Cross Reactivity Human
Applications WB
Immunogen SUMO3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVPESSLAGHSF
Assay Information SUMO3 Blocking Peptide, catalog no. 33R-6376, is also available for use as a blocking control in assays to test for specificity of this SUMO3 antibody


Western Blot analysis using SUMO3 antibody (70R-3146)

SUMO3 antibody (70R-3146) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 12 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SUMO3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SUMO proteins, such as SUMO3, and ubiquitin posttranslationally modify numerous cellular proteins and affect their metabolism and function. However, unlike ubiquitination, which targets proteins for degradation, sumoylation participates in a number of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, and protein stability.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SUMO3 antibody (70R-3146) | SUMO3 antibody (70R-3146) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
View Our Distributors