SURF6 antibody (70R-1325)

Rabbit polyclonal SURF6 antibody raised against the middle region of SURF6

Synonyms Polyclonal SURF6 antibody, Anti-SURF6 antibody, SURF-6 antibody, SURF 6 antibody, SURF6, SURF 6, SURF-6, Surfeit 6 antibody
Specificity SURF6 antibody was raised against the middle region of SURF6
Cross Reactivity Human
Applications IHC, WB
Immunogen SURF6 antibody was raised using the middle region of SURF6 corresponding to a region with amino acids EPREPPGLIFNKVEVSEDEPASKAQRRKEKRQRVKGNLTPLTGRNYRQLL
Assay Information SURF6 Blocking Peptide, catalog no. 33R-2644, is also available for use as a blocking control in assays to test for specificity of this SURF6 antibody


Immunohistochemical staining using SURF6 antibody (70R-1325)

SURF6 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 40 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SURF6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene is located in the surfeit gene cluster, a group of very tightly linked genes that do not share sequence similarity. The gene demonstrates features of a housekeeping gene, being ubiquitously expressed, and the encoded protein has been localized to the nucleolus. The protein includes motifs found in both the mouse and fish orthologs, which suggests a putative function as a nucleolar-matrix protein with nucleic acid-binding properties, based on characteristics determined in mouse.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using SURF6 antibody (70R-1325) | SURF6 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows)  in Human Kidney. Magnification is at 400X.
  • Western Blot analysis using SURF6 antibody (70R-1325) | SURF6 antibody (70R-1325) used at 2.5 ug/ml to detect target protein.
  • Immunohistochemical staining using SURF6 antibody (70R-1325) | SURF6 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Myocardial cells (arrows) in Human Heart. Magnification is at 400X

Availability: In stock

Price: €258.73
Size: 100 ug
View Our Distributors