SYCP1 Blocking Peptide (33R-6689)
A synthetic peptide for use as a blocking control in assays to test for specificity of SYCP1 antibody, catalog no. 70R-5607
Overview
Overview
| Synonyms | SYCP1 control peptide, SYCP1 antibody Blocking Peptide, Anti-SYCP1 Blocking Peptide, Synaptonemal Complex Protein 1 Blocking Peptide, HOM-TES-14 Blocking Peptide, MGC104417 Blocking Peptide, SCP1 Blocking Peptide, SYCP1, SYCP-1, SYCP 1, SYCP-1 Blocking Peptide, SYCP 1 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | NFLPVLEQVGNSDCHYQEGLKDSDLENSEGLSRVYSKLYKEAEKIKKWKV |
|---|---|
| Molecular Weight | 107 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | SYCP1 is a major component of the transverse filaments of synaptonemal complexes (SCS), which is formed between homologous chromosomes during meiotic prophase. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product