SYCP1 Blocking Peptide (33R-6689)

A synthetic peptide for use as a blocking control in assays to test for specificity of SYCP1 antibody, catalog no. 70R-5607

Synonyms SYCP1 control peptide, SYCP1 antibody Blocking Peptide, Anti-SYCP1 Blocking Peptide, Synaptonemal Complex Protein 1 Blocking Peptide, HOM-TES-14 Blocking Peptide, MGC104417 Blocking Peptide, SCP1 Blocking Peptide, SYCP1, SYCP-1, SYCP 1, SYCP-1 Blocking Peptide, SYCP 1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues NFLPVLEQVGNSDCHYQEGLKDSDLENSEGLSRVYSKLYKEAEKIKKWKV
Molecular Weight 107 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SYCP1 is a major component of the transverse filaments of synaptonemal complexes (SCS), which is formed between homologous chromosomes during meiotic prophase.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors