SYDE1 antibody (70R-3763)

Rabbit polyclonal SYDE1 antibody

Synonyms Polyclonal SYDE1 antibody, Anti-SYDE1 antibody, FLJ13511 antibody, SYDE 1, SYDE1, 7h3 antibody, Synapse Defective 1 Rho Gtpase Homolog 1 antibody, SYDE-1 antibody, SYDE 1 antibody, SYDE-1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen SYDE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PYLRPKRQPPLHLPLADPEVVTRPRGRGGPESPPSNRYAGDWSVCGRDFL
Assay Information SYDE1 Blocking Peptide, catalog no. 33R-7447, is also available for use as a blocking control in assays to test for specificity of this SYDE1 antibody


Western Blot analysis using SYDE1 antibody (70R-3763)

SYDE1 antibody (70R-3763) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 80 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SYDE1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SYDE1 contains 1 Rho-GAP domain. It is a GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SYDE1 antibody (70R-3763) | SYDE1 antibody (70R-3763) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors